PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00051978001
Common NameNF-YA9B
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 299aa    MW: 32927.1 Da    PI: 9.0422
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00051978001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.12.6e-32160216158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep+YVNaKQyq+I++RRq+Rak+e ekkl +ksrk+ylheSRh+hA+rRpRg+gGrF
  GSBRNA2T00051978001 160 QEPVYVNAKQYQAIMRRRQARAKAELEKKL-IKSRKRYLHESRHQHAMRRPRGTGGRF 216
                          69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.5E-36158219IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.361159219IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.7E-27161216IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.5E-24162184IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860164184IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.5E-24193216IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MHSKSKSGNQ IVSEAHHHTS SSSINSLNPW LRAAASCDAN SSVEEAGDKS IALENQTNLE  60
SSNGSKSPSN RDENGNKESQ VTASPQQSAA DYSEKSQELV HPGSTPPPHP QLVSHTVGWA  120
SSNPYQDSYY AGMMGAYPLT YVPHGGMPHS RMQLPPEMAQ EPVYVNAKQY QAIMRRRQAR  180
AKAELEKKLI KSRKRYLHES RHQHAMRRPR GTGGRFAKKT NTEASQQKDG EKRNACATQS  240
PTSSHSDQHE GCSDEYRTNQ SDEMQSSAYK IREEAGCSGQ QWNNISSNHP SQPLLAIK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-19160216258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.21780.0bud| flower| leaf| microspore| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00051978001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBNU338840.0U33884.1 Brassica napus clone bncbf-b1 CCAAT-binding factor B subunit homolog mRNA, complete cds.
GenBankBNU338850.0U33885.1 Brassica napus clone bncbf-b2 CCAAT-binding factor B subunit homolog mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013685025.10.0PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X3
RefseqXP_013685026.10.0PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X3
SwissprotQ945M91e-145NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLW6DGL30.0W6DGL3_BRANA; Transcription factor subunit NF-YA9B
STRINGBra001806.1-P1e-178(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132681829
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.11e-146nuclear factor Y, subunit A9
Publications ? help Back to Top
  1. Liang M, et al.
    Identification and characterization of NF-Y transcription factor families in Canola (Brassica napus L.).
    Planta, 2014. 239(1): p. 107-26
    [PMID:24097262]